PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023987m
Common NameCARUB_v10023987mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 233aa    MW: 26274.1 Da    PI: 9.4354
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023987mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72.1e-32158215158
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                      ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  Carubv10023987m 158 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 215
                      59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.1E-34143215IPR003657WRKY domain
SuperFamilySSF1182901.83E-28150215IPR003657WRKY domain
PROSITE profilePS5081129.585153215IPR003657WRKY domain
SMARTSM007741.3E-37158217IPR003657WRKY domain
PfamPF031063.6E-25159215IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
KDLRIKTMEG VGGSGGRRVV NNYDLHQVTS STTTIHQENM NFLIPFEETN VLTFFSSSSS  60
SSLSSPSFPI HNPSSSTTSH HAPLGFSNHL HQGGGPLGPK VVNDDQENFR GGTNNDAHSN  120
SWWRSSSGSI DMKNKVKIRR KLREPRFCFQ TKSDVDVLDD GYKWRKYGQK VVKNSLHPRS  180
YYRCTHNNCR VKKRVERLSE DCRMVITTYE GRHNHIPSDD STSPDHDCIS SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26149215874Probable WRKY transcription factor 4
2lex_A2e-26149215874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142KIRRKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4048570.0AF404857.1 Arabidopsis thaliana WRKY transcription factor 12 (WRKY12) mRNA, complete cds.
GenBankBT0289920.0BT028992.1 Arabidopsis thaliana At2g44745 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294932.11e-174hypothetical protein CARUB_v10023987mg, partial
SwissprotQ93WY41e-133WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLR0HR971e-174R0HR97_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.4__2664__AT2G44745.11e-132(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60452546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-120WRKY family protein